Protein Info for DvMF_0463 in Desulfovibrio vulgaris Miyazaki F

Annotation: GCN5-related N-acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF13302: Acetyltransf_3" amino acids 2 to 142 (141 residues), 46.6 bits, see alignment E=1.7e-15 PF13420: Acetyltransf_4" amino acids 3 to 159 (157 residues), 52 bits, see alignment E=2.5e-17 PF00583: Acetyltransf_1" amino acids 16 to 141 (126 residues), 64.8 bits, see alignment E=2.7e-21 PF13508: Acetyltransf_7" amino acids 54 to 143 (90 residues), 37.2 bits, see alignment E=9.6e-13 PF13673: Acetyltransf_10" amino acids 88 to 149 (62 residues), 30.6 bits, see alignment E=9.3e-11 PF08445: FR47" amino acids 89 to 143 (55 residues), 33.1 bits, see alignment E=1.4e-11

Best Hits

Swiss-Prot: 58% identical to MDDA_PSEAE: L-methionine sulfoximine/L-methionine sulfone acetyltransferase (pitA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to dvm:DvMF_0463)

MetaCyc: 57% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DJU8 at UniProt or InterPro

Protein Sequence (178 amino acids)

>DvMF_0463 GCN5-related N-acetyltransferase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MLIRDAESGDIEGIVAIYNDAVCNTTAIWNESVTDAAGRAAWLADRRAAGHPVLVAVEAG
RNGGPVVLGYATFGDWRAWDGYRHTVEHSVYVHKDTRGRGLGAALLHALIGRARDMGKHV
MVAGVEAGNEASMALHRKMGFTEVGMLREVGCKFGRWLDLAFLQLTLDARETPPARPR