Protein Info for DvMF_0324 in Desulfovibrio vulgaris Miyazaki F

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00890: FAD_binding_2
  • amino acids 142 to 178 (37 residues), 24.8 bits, 1.2e-08
• PF12831: FAD_oxidored
  • amino acids 142 to 179 (38 residues), 33.3 bits, 3.3e-11
• PF01134: GIDA
  • amino acids 142 to 197 (56 residues), 23.8 bits, 2.2e-08
• PF13450: NAD_binding_8
  • amino acids 144 to 181 (38 residues), 21.9 bits, 1.7e-07
• PF00037: Fer4
  • amino acids 236 to 253 (18 residues), 28.5 bits, see alignment (E = 9.3e-10)
  • amino acids 579 to 600 (22 residues), 28.8 bits, see alignment (E = 7.4e-10)
  • amino acids 612 to 633 (22 residues), 21.4 bits, see alignment (E = 1.6e-07)
• PF12800: Fer4_4
  • amino acids 240 to 253 (14 residues), 16.6 bits, see alignment (E = 7.8e-06)
  • amino acids 583 to 597 (15 residues), 15.9 bits, see alignment (E = 1.3e-05)
  • amino acids 616 to 630 (15 residues), 11.7 bits, see alignment (E = 0.0003)
• PF12798: Fer4_3
  • amino acids 242 to 254 (13 residues), 14.4 bits, see alignment (E = 5.8e-05)
  • amino acids 584 to 598 (15 residues), 16 bits, see alignment (E = 1.7e-05)
• PF12837: Fer4_6
  • amino acids 578 to 599 (22 residues), 28.5 bits, see alignment (E = 1e-09)
• PF14697: Fer4_21
  • amino acids 578 to 634 (57 residues), 40.2 bits, 2.9e-13
• PF13187: Fer4_9
  • amino acids 583 to 632 (50 residues), 33.5 bits, 3.2e-11
• PF12838: Fer4_7
  • amino acids 583 to 631 (49 residues), 40.8 bits, 2.4e-13

Best Hits

Swiss-Prot: 54% identical to HDRA2_METKA: CoB--CoM heterodisulfide reductase iron-sulfur subunit A 2 (hdrA2) from Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

KEGG orthology group: K03388, heterodisulfide reductase subunit A [EC: 1.8.98.1] (inferred from 100% identity to dvm:DvMF_0324)

MetaCyc: 52% identical to H(2):CoB-CoM heterodisulfide,ferredoxin reductase alpha component monomer (Methanothermobacter thermautotrophicus)
RXN-18521 [EC: 1.8.98.5]

Predicted SEED Role

"CoB--CoM heterodisulfide reductase subunit A (EC 1.8.98.1)" in subsystem Anaerobic respiratory reductases or H2:CoM-S-S-HTP oxidoreductase or Methanogenesis (EC 1.8.98.1)

MetaCyc Pathways

• coenzyme B/coenzyme M regeneration IV (H₂-dependent) (1/1 steps found)
• coenzyme B/coenzyme M regeneration I (methanophenazine-dependent) (1/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.8.98.1

Use Curated BLAST to search for 1.8.98.1 or 1.8.98.5

Sequence Analysis Tools

See B8DPJ4 at UniProt or InterPro

Protein Sequence (652 amino acids)

>DvMF_0324 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MRIGVFVCHCGSNIGGTVDVPGVAEVARAYPDVVFSSDTMYACSEPGQAAIVDAIREHAL
DGVVVASCTPRMHEPTFRRTVERAGLNRYMFEMANIREHVSWIGKDREANSNKAAELVRM
AVEKLRLNAPLYPKSFDVTKRVLVIGGGVAGIQAALDCADGGIEVVLVERESTIGGKMAK
LDKTFPTVDCSSCILGPKMVDVSQHPNIRLYAHAEVEKIGGYVGNFKVDVRRKATYVDWE
LCTGCGLCMEKCPSRKSPDAFNEHVGVTTSINIPFPQAIPKKAIIDPTSCRQFVKGKCGV
CAKVCPTGAIRYDMEDQVVTEEVGAIITATGYDLFDYTKYAEYGGGRYPDVITSLQYERL
LSASGPTGGHVKRPSDGKEPKTVVFIQCVGSRDRSVDRPYCSGFCCMYTAKQAVLTKDHI
PDSRSYVFYMDIRANGKMYEEFTRRAMEEYGVQYVRGRVSMIVPQGDTYLVRGVDTLLGE
QVEVPADLVVLAVGAESSHGAPQLAEKLRISYDNYGFFMESHCKLRPVETNTAGVYLAGA
CQGPKDIPSSVGQGSAAAAKVLGLFSRGRLESDPQISQVDVRRCVGCGKCITTCPYGAIE
WMELRGEMKARVIETVCQGCGICTVTCPQGAIQLQHFTDNQILAEVNALCLS