Protein Info for DvMF_0315 in Desulfovibrio vulgaris Miyazaki F

Annotation: SSS sodium solute transporter superfamily (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 277 to 301 (25 residues), see Phobius details amino acids 330 to 358 (29 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 404 to 427 (24 residues), see Phobius details amino acids 434 to 458 (25 residues), see Phobius details amino acids 478 to 495 (18 residues), see Phobius details TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 44 to 443 (400 residues), 186 bits, see alignment E=6e-59 PF00474: SSF" amino acids 44 to 443 (400 residues), 363.2 bits, see alignment E=8.7e-113

Best Hits

Swiss-Prot: 63% identical to ACTP_CITK8: Cation/acetate symporter ActP (actP) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 100% identity to dvm:DvMF_0315)

MetaCyc: 62% identical to acetate/glycolate:cation symporter (Escherichia coli K-12 substr. MG1655)
RXN0-1981; RXN0-5111; TRANS-RXN0-576

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPI5 at UniProt or InterPro

Protein Sequence (519 amino acids)

>DvMF_0315 SSS sodium solute transporter superfamily (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MASEFTSTIGQPNALSIGFFFLFVAFTLGVTWWAARRSRSAAEFYAAGRSVTGFQNGLAL
AGDYMSAASFLGIAGLVALKGYDGLIYSIGFLVGWPVMMFLIAEPLRNLGKYTFADVVAY
RLRQRPIRVAAACGSLMTVAFYLIAQMVGSGSLVHLMFGLPYETAVLVVGAVMIAYVLFG
GMLATTWVQIIKAVLLLGGASVMVFFVLRHFGFSPAELFRASAARYGDKVLAPGGLVSNP
WDALSLGMALMFGTAGLPHILMRFYTVPDAKAARKSVFYATGLISYFYVLTFIIGFGAMT
LVGQEVVAGFDKGGNMAALLLAEVTGGTMFLGFIAAVAFATILAVVAGLTLAGATTYAHD
LYANVFRRGQSTEDDEVRMAKRATVALGVLAVALGIAFKGQNVAFMVGLAFAIAASANFP
ALLMSILWKRFSTFGAVCSIATGATLAVGLIVLSPTVWVDVLHSPWGMAAPFMLKNPALI
SLPAAFAAGWLGSVLRPEPDAEQRYAEQKIRNYLGVGAE