Protein Info for DvMF_0256 in Desulfovibrio vulgaris Miyazaki F

Annotation: AMP-dependent synthetase and ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 93 to 113 (21 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details PF00501: AMP-binding" amino acids 35 to 424 (390 residues), 315 bits, see alignment E=6.3e-98 PF13193: AMP-binding_C" amino acids 474 to 549 (76 residues), 81.5 bits, see alignment E=6.7e-27

Best Hits

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 100% identity to dvm:DvMF_0256)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.3

Use Curated BLAST to search for 6.2.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPC6 at UniProt or InterPro

Protein Sequence (583 amino acids)

>DvMF_0256 AMP-dependent synthetase and ligase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTEPNTSADFPWLASYDAGVPANISYETFPLFTLLDRAAERTPRRTAIAFRNYRISYAKL
RQLAEVMAANLRAQGVRRGDKVSIMLPNLPQTVIAFWAVLKAGGVVVMTNPLYMEKELVH
QIHDSGARFMIALDLVWPKIEPLREKLGIDKYFLTRIGDGLAFPLNFLYAFKAKREGTWR
ELPFDGRHVLPWKTLLKGKVRHSTTTCNPTEDLAVLQYTGGTTGISKGVMLTHHNMSVNV
QQITTILGDARDMDHCFLGLMPYFHVYGLTTCLTLPTALAATIVPFPRYVPRDVLVGIQK
HKPTIFPGAPSIYISLMQQKEVGDYDLTSIRYCISGSAPMPVEHIKRFRELTGAQVIEGF
GLTEASPVTHLNPIHGVSKTGSIGIPFPDTEARIVDMEVGQVPLPAGKVGELIIRGPQVM
KGYWNRPDETANTLRNGWLYTGDIAIMDEDGYFTIVDRKKDMFLVGGYNVYPREIDEVLH
EHPKIKEAVTVGVPHPTRGEMIKAFVVVKPGEKLTKAEVVAHCREKLASYKVPKQVEFRD
DLPKTVVGKVLRRILRTEEEEKLKAELAASPATAAASDDDGAQ