Protein Info for DvMF_0256 in Desulfovibrio vulgaris Miyazaki F

Annotation: AMP-dependent synthetase and ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 35 to 424 (390 residues), 312.1 bits, E=4.9e-97
• PF13193: AMP-binding_C
  • amino acids 474 to 549 (76 residues), 82.3 bits, E=3.9e-27

Best Hits

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 100% identity to dvm:DvMF_0256)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (47/53 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• long-chain fatty acid activation (1/1 steps found)
• palmitate biosynthesis III (21/29 steps found)
• phytol degradation (3/4 steps found)
• stearate biosynthesis IV (4/6 steps found)
• γ-linolenate biosynthesis II (animals) (1/2 steps found)
• linoleate biosynthesis II (animals) (1/2 steps found)
• alkane biosynthesis II (1/3 steps found)
• oleate biosynthesis I (plants) (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• octane oxidation (2/5 steps found)
• long chain fatty acid ester synthesis (engineered) (1/4 steps found)
• phosphatidylcholine acyl editing (1/4 steps found)
• wax esters biosynthesis II (1/4 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• 6-gingerol analog biosynthesis (engineered) (1/6 steps found)
• fatty acid salvage (1/6 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• arachidonate biosynthesis III (6-desaturase, mammals) (1/7 steps found)
• capsaicin biosynthesis (1/7 steps found)
• icosapentaenoate biosynthesis II (6-desaturase, mammals) (1/7 steps found)
• icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• sporopollenin precursors biosynthesis (4/18 steps found)
• cutin biosynthesis (1/16 steps found)
• suberin monomers biosynthesis (2/20 steps found)
• oleate β-oxidation (1/35 steps found)

KEGG Metabolic Maps

• Fatty acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.3

Use Curated BLAST to search for 6.2.1.3

Sequence Analysis Tools

See B8DPC6 at UniProt or InterPro

Protein Sequence (583 amino acids)

>DvMF_0256 AMP-dependent synthetase and ligase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTEPNTSADFPWLASYDAGVPANISYETFPLFTLLDRAAERTPRRTAIAFRNYRISYAKL
RQLAEVMAANLRAQGVRRGDKVSIMLPNLPQTVIAFWAVLKAGGVVVMTNPLYMEKELVH
QIHDSGARFMIALDLVWPKIEPLREKLGIDKYFLTRIGDGLAFPLNFLYAFKAKREGTWR
ELPFDGRHVLPWKTLLKGKVRHSTTTCNPTEDLAVLQYTGGTTGISKGVMLTHHNMSVNV
QQITTILGDARDMDHCFLGLMPYFHVYGLTTCLTLPTALAATIVPFPRYVPRDVLVGIQK
HKPTIFPGAPSIYISLMQQKEVGDYDLTSIRYCISGSAPMPVEHIKRFRELTGAQVIEGF
GLTEASPVTHLNPIHGVSKTGSIGIPFPDTEARIVDMEVGQVPLPAGKVGELIIRGPQVM
KGYWNRPDETANTLRNGWLYTGDIAIMDEDGYFTIVDRKKDMFLVGGYNVYPREIDEVLH
EHPKIKEAVTVGVPHPTRGEMIKAFVVVKPGEKLTKAEVVAHCREKLASYKVPKQVEFRD
DLPKTVVGKVLRRILRTEEEEKLKAELAASPATAAASDDDGAQ