Protein Info for DvMF_0241 in Desulfovibrio vulgaris Miyazaki F

Annotation: major facilitator superfamily MFS_1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 292 to 309 (18 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 277 (245 residues), 68.7 bits, see alignment E=2.2e-23 amino acids 239 to 401 (163 residues), 50.3 bits, see alignment E=8.6e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0241)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DPB1 at UniProt or InterPro

Protein Sequence (405 amino acids)

>DvMF_0241 major facilitator superfamily MFS_1 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MTADTTPPAAVSAMQADTAPAFAAALPWVGLVGLLFFVNYGSRAMLAPLLLSIEADLGLD
HAQATRLLFLMACGFTVSLAASAFLLSRVTPRRMAAFSCMATGAVLMGMAVVRDHATARC
MFVLMGLAAGLYFPAGMATLGTLSRQRDWGKAVSIHELGPNLSFVAVPLLAEAGLRVTDW
RGVLLAVGVASMLTGIVFAWVGRGGRTLAEPPSIRGFTGVLRSPLTWLFAWLLTVGVAGE
YAVFSVLPLHLVDGMGLAPGTANGLLAASRVITPFAALAGGWVADRMGARRTIAACLALT
GIALLAMAVPSATVVMAGMTVQGAMTAFIFPAIFKELARCWPAGYQPTVLCIATPASSLL
GTGAAPALLGLVGQTLGFGTGFALLGVLALVSIIPLRLLPPEAGR