Protein Info for DvMF_0199 in Desulfovibrio vulgaris Miyazaki F

Annotation: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 100% identity to dvm:DvMF_0199)

Predicted SEED Role

"Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.5.1.17)

MetaCyc Pathways

adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
adenosylcobalamin salvage from cobalamin (5/5 steps found)
adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
adenosylcobalamin biosynthesis II (aerobic) (25/33 steps found)
superpathway of adenosylcobalamin salvage from cobinamide I (7/8 steps found)
adenosylcobinamide-GDP salvage from cobinamide II (5/6 steps found)
superpathway of adenosylcobalamin salvage from cobinamide II (7/9 steps found)
cobalamin salvage (eukaryotic) (4/8 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNV2 at UniProt or InterPro

Protein Sequence (167 amino acids)

>DvMF_0199 ATP:corrinoid adenosyltransferase BtuR/CobO/CobP (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MLLIYTGNGKGKTSACVGQAIRALGQGLTVAFGQFMKRPGQAGEQKMLEHLLGERFRAGG
KGFLRREEDRPAHRKAAQELLQWAEDTLPDVDMLVLDETLYALGYDIVTRDEVEHLLELA
EPHGRHLVLSGRGLPDWLAGRADLVTEMNEVKHPWQKGVQATKGIEF