Protein Info for DvMF_0148 in Desulfovibrio vulgaris Miyazaki F

Annotation: HAD-superfamily hydrolase, subfamily IA, variant 1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00702: Hydrolase" amino acids 17 to 188 (172 residues), 70.5 bits, see alignment E=2.7e-23 PF13419: HAD_2" amino acids 19 to 192 (174 residues), 81.4 bits, see alignment E=9e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0148)

Predicted SEED Role

"HAD-superfamily hydrolase, subfamily IA, variant 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNQ2 at UniProt or InterPro

Protein Sequence (247 amino acids)

>DvMF_0148 HAD-superfamily hydrolase, subfamily IA, variant 1 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MYPTVHRLQQLFPRGLKGIIFDCDGVLFDSRASNIQYYNLILDALGQPPMSRQDEDYTHM
ASVGQSLARIVPPALMPGLPEARKRIVYRRDILPLLEPEPGLMELLRWLRDAGFHRGICT
NRTTTMEYVLDHFGMTELFFPVMTASRVRAKPHPEGICATLDSWGLARDEVAFMGDTIAD
EETARMAGVCFWAYRSPSLSARLHLDDFWALRRVLAEYVRHEQDGQLDGRQGAGKTLQGA
AFGCFHR