Protein Info for DvMF_0140 in Desulfovibrio vulgaris Miyazaki F

Annotation: dTDP-4-dehydrorhamnose reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01370: Epimerase" amino acids 8 to 183 (176 residues), 66.2 bits, see alignment E=3.2e-22 PF04321: RmlD_sub_bind" amino acids 8 to 283 (276 residues), 272.4 bits, see alignment E=3.9e-85 TIGR01214: dTDP-4-dehydrorhamnose reductase" amino acids 9 to 282 (274 residues), 252.5 bits, see alignment E=2.2e-79

Best Hits

Swiss-Prot: 37% identical to RMLD_MYCS2: dTDP-4-dehydrorhamnose reductase (rmlD) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 100% identity to dvm:DvMF_0140)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNP4 at UniProt or InterPro

Protein Sequence (293 amino acids)

>DvMF_0140 dTDP-4-dehydrorhamnose reductase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSPRPKALVLGGRTGLLGQALVRVLRESGWDALPTGRDDVNVLDSGALASFIERAEPAVI
FNTVAWTQVDLAEEREEDATRLNRQLPTCLARMVRGTPMHLVHFSTDFVFSGRKGTPYTP
EDTPDPASVYGATKLAGEQAVLQQCPDNACVVRTSWLFGPGRRNFVKVILDICHDKGEAR
VVHDQIGSPTYTLDLAAGSVKLAELRATGIFHVANAGQASWCELASEAVNLAGLPCKVHA
IPSRDYPQKAQRPPFSVLDTARFTQMTGITPRPWPQALRDYIYKECLPGTHDA