Protein Info for DvMF_0125 in Desulfovibrio vulgaris Miyazaki F
Annotation: Polyprenyl synthetase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K13789, geranylgeranyl diphosphate synthase, type II [EC: 2.5.1.1 2.5.1.10 2.5.1.29] (inferred from 100% identity to dvm:DvMF_0125)Predicted SEED Role
No annotation
MetaCyc Pathways
- polyisoprenoid biosynthesis (E. coli) (5/5 steps found)
- trans, trans-farnesyl diphosphate biosynthesis (2/2 steps found)
- superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (9/12 steps found)
- geranyl diphosphate biosynthesis (1/1 steps found)
- geranylgeranyl diphosphate biosynthesis (1/1 steps found)
- taxadiene biosynthesis (engineered) (9/13 steps found)
- (3R)-linalool biosynthesis (1/2 steps found)
- (3S)-linalool biosynthesis (1/2 steps found)
- linalool biosynthesis I (1/2 steps found)
- all-trans-farnesol biosynthesis (2/4 steps found)
- methyl phomopsenoate biosynthesis (2/4 steps found)
- ophiobolin F biosynthesis (1/3 steps found)
- plaunotol biosynthesis (1/3 steps found)
- superpathway of linalool biosynthesis (1/3 steps found)
- ipsdienol biosynthesis (1/4 steps found)
- bisabolene biosynthesis (engineered) (2/6 steps found)
- mono-trans, poly-cis decaprenyl phosphate biosynthesis (1/5 steps found)
- stellatic acid biosynthesis (3/8 steps found)
- paspaline biosynthesis (1/6 steps found)
- brassicicene C biosynthesis (1/7 steps found)
- superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (3/10 steps found)
- superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (4/12 steps found)
- fusicoccin A biosynthesis (1/8 steps found)
- viridicatumtoxin biosynthesis (1/9 steps found)
- superpathway of phylloquinol biosynthesis (1/15 steps found)
- superpathway of ergosterol biosynthesis II (8/26 steps found)
- superpathway of chorismate metabolism (31/59 steps found)
- superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
- superpathway of ergosterol biosynthesis I (2/26 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)
- superpathway of cholesterol biosynthesis (2/38 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Terpenoid biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.5.1.1 or 2.5.1.10 or 2.5.1.29
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B8DNM9 at UniProt or InterPro
Protein Sequence (313 amino acids)
>DvMF_0125 Polyprenyl synthetase (RefSeq) (Desulfovibrio vulgaris Miyazaki F) MLTPSEIKTRLRDAAAGVERYLAACLADRGIPARLRASMEYSLNAGGKRVRPVLCLTTAA LFGLPTERVMPFAAAIEMIHTYSLIHDDLPAMDDDDLRRGKPSNHKMFDEATAILAGDGL LTDAFDFMAGVGAGVGAAAGDENGGNAAIPAANVLAALRAVARAAGAPGMVGGQALDMEY TGRTGVTLEEMAAMHAMKTGALLRASCLSGALLAGADADALARIADYGAHIGAAFQIVDD ILDEVGDEAEIGKPVGSDAEQGKTTYPSLLGVERSRALARERADAAIERLSPYTGPDADF LRSLASYIVDRAS