Protein Info for DvMF_0118 in Desulfovibrio vulgaris Miyazaki F

Annotation: ABC transporter related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF00005: ABC_tran" amino acids 37 to 187 (151 residues), 104 bits, see alignment E=1e-33

Best Hits

KEGG orthology group: K09817, zinc transport system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to dvm:DvMF_0118)

Predicted SEED Role

"Zinc ABC transporter, ATP-binding protein ZnuC" in subsystem Transport of Zinc

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNM2 at UniProt or InterPro

Protein Sequence (308 amino acids)

>DvMF_0118 ABC transporter related (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MHMPSSASGMPGAPHTPHEPVIAVRDLCFAYGDEPVLDHVDLTVERGEFLAVLGPNGGGK
TTLLKLLLGLLTPRSGSVALFGGAPRAALPRIGYVPQYSTARLDFPVTVLDVVLMGLAGT
RRGLLGRHWSRDAASIDRAREALDQVGLSGMEQRMVGALSGGQRQRAVVARALMAQPELL
LLDEPTASIDPQGSFCFFEFLGTLRGPHTLVVVSHDLSIATSTFSNVAFVNRTLVHSRGA
GLTPDMLTMLYGHHEKTCPMGAFITSVSGLFPVLPRMDELSPSDATLPVSPGAPDAPDAA
PSPVAKDA