Protein Info for DvMF_0099 in Desulfovibrio vulgaris Miyazaki F

Name: secY
Annotation: preprotein translocase subunit SecY (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 368 to 388 (21 residues), see Phobius details amino acids 394 to 412 (19 residues), see Phobius details TIGR00967: preprotein translocase, SecY subunit" amino acids 16 to 424 (409 residues), 418.3 bits, see alignment E=1.6e-129 PF00344: SecY" amino acids 72 to 412 (341 residues), 390.2 bits, see alignment E=3.9e-121

Best Hits

Swiss-Prot: 51% identical to SECY_SHIFL: Protein translocase subunit SecY (secY) from Shigella flexneri

KEGG orthology group: K03076, preprotein translocase subunit SecY (inferred from 100% identity to dvm:DvMF_0099)

MetaCyc: 51% identical to Sec translocon subunit SecY (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase secY subunit (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DNK3 at UniProt or InterPro

Protein Sequence (437 amino acids)

>DvMF_0099 preprotein translocase subunit SecY (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MALSGVENLARLPELRKKLFWTFLLLAAYRIGVHVPVPGVDSGALADFFASVQNTLFGLF
DMFSGGGLRNLSVFALGIMPYISASIIIQLLQVVSPELKRMAKEEGAAGRRKITQYTRYA
TVLITVIQGFGIAVGLENMHSPAGAPVVLDAGWGFRMITIATLTAGTVLIMWLGEQITEK
GIGNGISLIIFSGIVAGIPGGIVKSGQLIKAGDMSVFTAILVLALMAVVLGCIVFMERGQ
RRIPIHYAKRQVGRKMFGGQSTHLPLRINTAGVIPPIFASSLLLFPATIASFSANETLQR
VAAWFAPHTVMYNILFISLIVFFCFFYTAIIFDPKDIAENLKKGGGFIPGIRPGDKTRQY
IDRVLTRMTIWGAIYISAICVLPMILIAQFNVPFYFGGTSVLILVGVAMDFMSQVESHLI
SRQYEGLMNKTRIKGRQ