Protein Info for DvMF_0067 in Desulfovibrio vulgaris Miyazaki F

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13247: Fer4_11
  • amino acids 121 to 171 (51 residues), 47.6 bits, 4.8e-16
• PF12837: Fer4_6
  • amino acids 146 to 168 (23 residues), 28.8 bits, see alignment (E = 2.5e-10)
• PF00037: Fer4
  • amino acids 148 to 169 (22 residues), 23.6 bits, see alignment (E = 1.1e-08)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0067)

MetaCyc: 74% identical to DsrO (Desulfovibrio vulgaris Hildenborough)
1.8.5.h [EC: 1.8.5.h]

Predicted SEED Role

"Sulfite reduction-associated complex DsrMKJOP iron-sulfur protein DsrO (=HmeA)" in subsystem Sulfate reduction-associated complexes

MetaCyc Pathways

• dissimilatory sulfate reduction I (to hydrogen sufide)) (5/5 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (4/6 steps found)
• superpathway of tetrathionate reduction (Salmonella typhimurium) (2/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.h

Sequence Analysis Tools

See B8DN84 at UniProt or InterPro

Protein Sequence (259 amino acids)

>DvMF_0067 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSTTRRQFLKIAGLAAFGLGTSSALDAADAVAKDMPGAKYDVGGKHLAAKRWAMVIDTRK
LESREDFERIIHACHSVHNVPSIPSKQEIKWIWTDKYDRVFTDDMSQHLSPAVREKDYLL
LCNHCENPPCVRVCPTKATFKRADGIVVMDYHRCIGCRFCMAGCPYGARSFNFGDPRPYL
KDVNPAFPTRMRGVVEKCTFCSERLEVGLLPACVEASNGAILFGDLDDPNSPVRKALAEN
FSIRRKPSIGTQPGVYYIV