Protein Info for DvMF_0067 in Desulfovibrio vulgaris Miyazaki F

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13247: Fer4_11" amino acids 121 to 171 (51 residues), 47.6 bits, see alignment 4.8e-16 PF12837: Fer4_6" amino acids 146 to 168 (23 residues), 28.8 bits, see alignment (E = 2.5e-10) PF00037: Fer4" amino acids 148 to 169 (22 residues), 23.6 bits, see alignment (E = 1.1e-08)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0067)

MetaCyc: 74% identical to DsrO (Desulfovibrio vulgaris Hildenborough)
1.8.5.h [EC: 1.8.5.h]

Predicted SEED Role

"Sulfite reduction-associated complex DsrMKJOP iron-sulfur protein DsrO (=HmeA)" in subsystem Sulfate reduction-associated complexes

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.h

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DN84 at UniProt or InterPro

Protein Sequence (259 amino acids)

>DvMF_0067 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSTTRRQFLKIAGLAAFGLGTSSALDAADAVAKDMPGAKYDVGGKHLAAKRWAMVIDTRK
LESREDFERIIHACHSVHNVPSIPSKQEIKWIWTDKYDRVFTDDMSQHLSPAVREKDYLL
LCNHCENPPCVRVCPTKATFKRADGIVVMDYHRCIGCRFCMAGCPYGARSFNFGDPRPYL
KDVNPAFPTRMRGVVEKCTFCSERLEVGLLPACVEASNGAILFGDLDDPNSPVRKALAEN
FSIRRKPSIGTQPGVYYIV