Protein Info for DvMF_0064 in Desulfovibrio vulgaris Miyazaki F

Annotation: histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00072: Response_reg" amino acids 28 to 134 (107 residues), 94 bits, see alignment E=1e-30 amino acids 450 to 562 (113 residues), 87.1 bits, see alignment E=1.4e-28 PF00512: HisKA" amino acids 182 to 247 (66 residues), 70.4 bits, see alignment E=1.6e-23 PF02518: HATPase_c" amino acids 294 to 423 (130 residues), 80.8 bits, see alignment E=1.6e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0064)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DN81 at UniProt or InterPro

Protein Sequence (598 amino acids)

>DvMF_0064 histidine kinase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSSASGFFALPGSSGSSGSPNLSDAPTVVVIDDDTMVRRSITAYLEDLGYNVHEGTDGRT
GLALVRSVQPDAVLVDLRMPGIDGLDVLRELATERPDMPTIVVSGTGVMQDAIEAVRRGA
WDFILKPIMDLEVLGHRVRLAIEQGRLRAENRRYHQNLAAEVAVRTHELEQARVEAESAN
RAKTQFLANISHELRTPLNGIIGLTELLLAAGPAGEQEECLGMVRQAGLDLLSIVNNLLD
MSSIEAGRIALNEAPFNLRETVGDLVRVLDVQARWKNLTLACSVSPDVPDRLVGDAARLR
QVLTNLVINGIKYTEVGGVSLSVELDGALPPVPGAGQGAHAAHAGGPVGLRVTVEDTGVG
IASEKWERIFEPFTLAENFLTKKYGGAGLGLAISREIARMMGGDIAVRSQEGAGSTFVLT
MRFALGESVAPRPRDASLPVIRGVNRRLRIMVAEDDVINRKLALYFFERMGHDVITVSSG
IEVLAGLEREACDLLLMDIQMPEMDGLETIRALRGRKGVPSRVPVIAMTAHAMAGDRERF
LAEGMDGYVSKPVDFGCLVAEIENVLDARGLLDVSLGNLRSGPQDGAVNREDCRAEPE