Protein Info for DvMF_0038 in Desulfovibrio vulgaris Miyazaki F

Annotation: protein of unknown function DUF140 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 129 to 153 (25 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 268 to 298 (31 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 350 to 374 (25 residues), see Phobius details PF02405: MlaE" amino acids 166 to 374 (209 residues), 223.3 bits, see alignment E=1.3e-70

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to dvm:DvMF_0038)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DN55 at UniProt or InterPro

Protein Sequence (381 amino acids)

>DvMF_0038 protein of unknown function DUF140 (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MSHPATLTVTSAGTQGATSLRLAVSGAWNLDAPPDGAARASAMARLREPGVATVILVAEG
LGDWDSSLAIFVAGVVRACRERNLSVDTSGLPAGLIRLVDLSFAVPERAGAARGDARSGL
LERIGEAVLALPMPVGSTLDFIGEVAFALYRLARGKADMRRRDLLQFMSESGSAALPIVS
LISMLVGLILAFVGAVQLRVFGAQIYVASLVAIAMVRVMGAIMTGITMAGRTGASYAAIL
GTMQVNEEVDALATMGLRPVEQLVLPRLLALVVMLPLLTVYADLMGMLGGFIVGVFMLDL
NPMEYLNATREALSLANLWIGITHGAVFGVVVALCGCYHGMRCGRSASAVGAATTAAVVS
GIVSIIVCTAFITVACEVLGI