Protein Info for DvMF_0032 in Desulfovibrio vulgaris Miyazaki F

Annotation: diguanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 signal peptide" amino acids 16 to 17 (2 residues), see Phobius details transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 351 to 460 (110 residues), 94.4 bits, see alignment E=3.2e-31 PF00990: GGDEF" amino acids 354 to 480 (127 residues), 94.6 bits, see alignment E=2.8e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvm:DvMF_0032)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DN50 at UniProt or InterPro

Protein Sequence (578 amino acids)

>DvMF_0032 diguanylate cyclase (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MARFERHRNTPTMGVRGWLLLLALVAGLPTTIFSVFAMVEHMRAQQEKTDAELRRQVLAV
AQAVDAELSAKAAMLHALAASQDPERMDIGQLYRQAKGVGSVHREVQSLALAGHDGSQVF
NTWEQLGVALPPTGDLTSVRRALDEDRPVVSDLFQGSILHQPVTALGVPMQVDRGHRYVL
RMYIGVAAYARLLEEERLPEGWTSTLVDGQGTILARTLRPEVTVGQVVGPRLREVLHSSE
VMEADNREGVPVRFAVAPVGTWGWHAVVQVPVAMLQAAMRAYLLRLAGIGGACIVMGVAG
AWLLSRRFVREVELAARSCRLPEAEDEPARRTMVRELRQVGDELAAAREREEMALRDGLT
GLAGRALFLRHARRLLETSRHDTSLRLAVMFIDLDGFKQLNDRYGHAEGDAVLLRTARVL
EGAVRSSDVVGRLGGDEFVLCQVLQADTACEVARGVAARVVSGVAQIGLGVGCSVGIALG
RAGGYPELSGEDASAGLPDDGTDAGQTAMRPEDGGGGTGDGSGGADGLADGSPRGVEATL
PGAPAPLRVLLEEADKAMYVAKQAGKNSYHLQDMSTCE