Protein Info for DvMF_0012 in Desulfovibrio vulgaris Miyazaki F

Annotation: glyceraldehyde-3-phosphate dehydrogenase, type I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF00044: Gp_dh_N" amino acids 2 to 100 (99 residues), 106.3 bits, see alignment E=8.9e-35 TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I" amino acids 3 to 323 (321 residues), 398 bits, see alignment E=1.7e-123 PF02800: Gp_dh_C" amino acids 155 to 311 (157 residues), 203.6 bits, see alignment E=1.4e-64

Best Hits

Swiss-Prot: 59% identical to G3P_GEOSE: Glyceraldehyde-3-phosphate dehydrogenase (gap) from Geobacillus stearothermophilus

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 100% identity to dvm:DvMF_0012)

MetaCyc: 52% identical to Gap (Thermotoga maritima)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12

Use Curated BLAST to search for 1.2.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8DN30 at UniProt or InterPro

Protein Sequence (332 amino acids)

>DvMF_0012 glyceraldehyde-3-phosphate dehydrogenase, type I (RefSeq) (Desulfovibrio vulgaris Miyazaki F)
MIKLGMNGFGRIGRYLVRLLAETDDLGVVAINARADNASLARLFKYDSCHGTFRGEVGHD
DAGLIVNGRHIAVTRERAGEWKWKDLGIDISVETTGTIKDRAGLAQHLACGAKKSVISAP
AKDADVTVVMGVNHGDYDPAKHDVISAASCTTNCLAPAAKTIHEAFGIKHGLMTTVHSYT
MSQRILDGSHKDPRRARAAALSMIPTTTGAAKATTLVIPALAGKLDGMAVRVPTPNVSLV
DLTCELERPTSVEEVNALLKAAAEGPLLGNMGYTEEPLVSVDYMGSIYGGVVDALCTSVI
DGTMLKLIIWYDNEAGFTNQLVRLLRMVGKGL