Protein Info for Shewana3_4136 in Shewanella sp. ANA-3

Annotation: F0F1 ATP synthase subunit A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 234 to 259 (26 residues), see Phobius details TIGR01131: ATP synthase F0, A subunit" amino acids 25 to 259 (235 residues), 156.3 bits, see alignment E=5.7e-50 PF00119: ATP-synt_A" amino acids 36 to 258 (223 residues), 194.2 bits, see alignment E=1.4e-61

Best Hits

Swiss-Prot: 100% identical to ATP6_SHESA: ATP synthase subunit a (atpB) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K02108, F-type H+-transporting ATPase subunit a [EC: 3.6.3.14] (inferred from 99% identity to shm:Shewmr7_4023)

Predicted SEED Role

"ATP synthase F0 sector subunit a (EC 3.6.3.14)" (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2T4 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Shewana3_4136 F0F1 ATP synthase subunit A (RefSeq) (Shewanella sp. ANA-3)
MAAPGEALTPQGYIQHHLTNLHVGEGFWTWHIDSLFFSVGLGVLFLWIFRSVGKKATSGV
PGKLQCFIEMIVEFVDNSVKESFHGRNALIAPLALTIFVWVFMMNFMDMLPVDWLPWLAS
LAGVPYLKVVPTTDVNITFSLAIGVFVLIIYYSIKVKGVSGFVKELTLQPFNHKAMIPVN
LLLETVTLVAKPISLALRLFGNLYAGELIFILIALMYGTNLLLSSLGVTLQLGWLIFHIL
VITLQAFIFMMLTIVYLSMAHEDH