Protein Info for Shewana3_4119 in Shewanella sp. ANA-3

Annotation: alpha/beta hydrolase fold (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF12146: Hydrolase_4" amino acids 58 to 310 (253 residues), 205.8 bits, see alignment E=1.6e-64 PF00561: Abhydrolase_1" amino acids 63 to 310 (248 residues), 92.1 bits, see alignment E=1.1e-29 PF12697: Abhydrolase_6" amino acids 79 to 307 (229 residues), 52.8 bits, see alignment E=2.1e-17 PF00326: Peptidase_S9" amino acids 83 to 173 (91 residues), 26.6 bits, see alignment E=1e-09

Best Hits

KEGG orthology group: K01048, lysophospholipase [EC: 3.1.1.5] (inferred from 100% identity to she:Shewmr4_3914)

Predicted SEED Role

"Lysophospholipase L2 (EC 3.1.1.5)" in subsystem Synechocystis experimental or Triacylglycerol metabolism (EC 3.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.5

Use Curated BLAST to search for 3.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2R7 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Shewana3_4119 alpha/beta hydrolase fold (RefSeq) (Shewanella sp. ANA-3)
MSQTPLNFPREEFSKVAFSTEHDLNTSEQQAFWQTVVQDTLKTPDGLTLAYMMVKHPKAH
ASIVISSGRVESYLKYQELVFDLYQQGYSVFAIDHRGQGLSSRMTANPHQGHVRRFNDYI
DDFALFMQTVVLKHATSPLFLLGHSMGGAIGTLYLKQHPDVFTAAAFSAPMYGIKLPMPK
GFVRWLASKLDASLNGGEPNYVLSGQNYKAAPFKGNDLTHCQSRYQAYRELYDAAPKLQL
GSPTNRWLTESLDAADACVLATAHIRTPILILQASEDKIVDNAAQNLAVSSNCQLKVIAG
AAHEIFMEKDSYRNQALNYALDFFKRYATRDVDKQAV