Protein Info for Shewana3_4117 in Shewanella sp. ANA-3

Annotation: adenosine deaminase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF00962: A_deaminase" amino acids 7 to 327 (321 residues), 368.5 bits, see alignment E=3.1e-114 TIGR01430: adenosine deaminase" amino acids 7 to 328 (322 residues), 356.3 bits, see alignment E=6.8e-111 PF19326: AMP_deaminase" amino acids 192 to 324 (133 residues), 41.6 bits, see alignment E=5.9e-15

Best Hits

Swiss-Prot: 100% identical to ADD_SHESA: Adenosine deaminase (add) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 98% identity to son:SO_4731)

MetaCyc: 63% identical to adenosine deaminase (Escherichia coli K-12 substr. MG1655)
Adenosine deaminase. [EC: 3.5.4.4]; 3.5.4.4 [EC: 3.5.4.4]

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2R5 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Shewana3_4117 adenosine deaminase (RefSeq) (Shewanella sp. ANA-3)
MINTSIPLVDLHRHLDGNVRVNTIWELGHQHGIALPADSLETLAPFVQIQGKETSLVAFL
KKLDWMVAVLADLDAVKRVAYENVADAALSGLDYAELRFSPYYMAMNHKLPIEGVVEAVI
DGVKAGLKDYQVKINLIGIMSRSFGQAACTQELEGLLAHKQHLVAMDLAGDELGFPGELF
NEHFKRVRDAGLAITAHAGEAAGSQSMWQAIQELGATRIGHGVNAIHDPKLMEYLAKHRI
GIESCPTSNLHTSTVSSYAEHPFRTFMDAGVLISLNTDDPGVSAIDIKHEYRIAKSELGL
SDAELAQVQRNGVEMAFLSESERKALYAAKA