Protein Info for Shewana3_4099 in Shewanella sp. ANA-3

Annotation: glycosyl transferase, group 1 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF13439: Glyco_transf_4" amino acids 13 to 179 (167 residues), 43.3 bits, see alignment E=6e-15 PF00534: Glycos_transf_1" amino acids 196 to 340 (145 residues), 88.8 bits, see alignment E=4.6e-29 PF13692: Glyco_trans_1_4" amino acids 200 to 332 (133 residues), 81.8 bits, see alignment E=9e-27

Best Hits

KEGG orthology group: None (inferred from 99% identity to shm:Shewmr7_3987)

Predicted SEED Role

"Alpha-1,4-N-acetylgalactosamine transferase PglJ (EC 2.4.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2P7 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Shewana3_4099 glycosyl transferase, group 1 (RefSeq) (Shewanella sp. ANA-3)
MRIAIAIDSLAGGGAEKVMITLAKQFISLGHEPHFLVMEDNRYYETPDNLPVHQCFADKD
KDYDHFGRLGASVDKLRAKIAEIESRVGKFDLFLSNLDKTNLMMTKTGVTPLYVIVHSSV
EEELSRQFKLGPFAYYKKLRAKKALNGQHLITVSNGIAKEIQAKGRLQPASMRTIYNPFE
FNEIVAQSQQDNPQIPQGDYLIHVGRFAKQKRHDVLFEALKQTQNQLPVVLLCHNHKKAI
KAAKKYGIEKRLIIPGFQSNPFPWIKRAKALVLSSDFEGLPTVLIESLACGTPVVSSDCP
HGPNEILTGNLAPYLVPRRNPAALAKMIDAVVAQPPSLDNVEILAKVDATAIAEQYLALA
K