Protein Info for Shewana3_4073 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 10 to 202 (193 residues), 192.1 bits, see alignment E=4.8e-61 PF02592: Vut_1" amino acids 41 to 196 (156 residues), 124.7 bits, see alignment E=2.1e-40

Best Hits

Swiss-Prot: 58% identical to QPTR_ECOLI: Queuosine precursor transporter (yhhQ) from Escherichia coli (strain K12)

KEGG orthology group: K09125, hypothetical protein (inferred from 99% identity to son:SO_4715)

MetaCyc: 58% identical to queuosine precursor transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-412

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2M1 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Shewana3_4073 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MLTPAQLRRALLLLVGFHILIICVSNYLVQLPFQLFGFHTTWGAFSFPFVYLATDLTVRI
FGQTPARSIILKAMVPALMISYVMGVVFHQGSFQGIDSLSQWNTFVFRIAFASFAAYLIG
QLMDITVFARLRQSRSWWVAPAASTIVGNLVDTLVFFSVAFYASTDSFMAANWPEIAAVD
YSFKLLVSLGLFLPAYGVLLKVLQDKILQTSPQKSFS