Protein Info for Shewana3_4037 in Shewanella sp. ANA-3
Annotation: hypothetical protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RSMJ_SHESA: Ribosomal RNA small subunit methyltransferase J (rsmJ) from Shewanella sp. (strain ANA-3)
KEGG orthology group: None (inferred from 99% identity to she:Shewmr4_3828)MetaCyc: 66% identical to 16S rRNA m2G1516 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6731 [EC: 2.1.1.242]
Predicted SEED Role
"SAM-dependent methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-
Use Curated BLAST to search for 2.1.1.- or 2.1.1.242
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0L2I5 at UniProt or InterPro
Protein Sequence (261 amino acids)
>Shewana3_4037 hypothetical protein (RefSeq) (Shewanella sp. ANA-3) MAAISTCQTVIPLPIPVFFNQQFPTLVDICARWQLVFDADAPFELRFESDTLTLHKRDEP KLDGIVVDFVTGAVAHRRKFGGGRGQSIAKAVGLKQGVTPKVVDGTAGLGRDAFVLASLG CTVIMVERHPVVAALLEDGLRRAYQDAEIGDWMRERMQLFHGSSLEALAKLEQEVDVVYL DPMYPHRDKSALVKKEMRVFQTLVGADLDADGLLAPAMALASKRVVVKRPDYAEDLAGVK PSMVIETKKNRFDVYVKSAMK