Protein Info for Shewana3_4035 in Shewanella sp. ANA-3

Annotation: protoheme IX farnesyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 49 to 73 (25 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 222 to 239 (18 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 18 to 296 (279 residues), 290.2 bits, see alignment E=1.1e-90 PF01040: UbiA" amino acids 32 to 279 (248 residues), 187.5 bits, see alignment E=1.4e-59

Best Hits

Swiss-Prot: 100% identical to CYOE2_SHESA: Protoheme IX farnesyltransferase 2 (cyoE2) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to she:Shewmr4_3827)

MetaCyc: 61% identical to heme O synthase (Escherichia coli K-12 substr. MG1655)
HEMEOSYN-RXN [EC: 2.5.1.141]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.141

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2I3 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Shewana3_4035 protoheme IX farnesyltransferase (RefSeq) (Shewanella sp. ANA-3)
MNTQARLTSTQWKARFKGYVQVTKPGIIFGNLISVAGGFLLAAKGDVDLVLMLASLVGLS
LVVASGCAINNCIDRDIDAKMQRTCKRVTVTGEIPLSHVLLFGIALGVLGFGILALFTNA
LALLFAAIGYVVYVGIYSLYMKRNSVYGTLVGSFSGAVPPVVGYCSVTGQMDMGAVILLL
MFSLWQMPHSYAIAIFRFNDYAAAKIPVLPVAEGMAKAKHHIVLYIAVFALVSTMLPLAG
YTGTAFMAVTCATSLWWLTMALKGYRQDVDMPRWARQVFGFSIITITALSVTMALDFQAV
SQTPLFTLVR