Protein Info for Shewana3_4026 in Shewanella sp. ANA-3

Annotation: ATPase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 180 to 201 (22 residues), see Phobius details PF02518: HATPase_c" amino acids 347 to 450 (104 residues), 75.1 bits, see alignment E=8.9e-25 PF14501: HATPase_c_5" amino acids 349 to 440 (92 residues), 33.3 bits, see alignment E=5.9e-12

Best Hits

KEGG orthology group: K07637, two-component system, OmpR family, sensor histidine kinase PhoQ [EC: 2.7.13.3] (inferred from 100% identity to shn:Shewana3_4026)

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2H4 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Shewana3_4026 ATPase domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MSKRALAWQLLNSLKTRLVLSALLFILVLLPLIGVALNDAFTEQVKSAAKNELSAYVYSV
LAVTEVENKRIFIPELVLENRFNLIQSGLYAIATTENAEHQQNIVWHSQSFMGITPPEHF
TIPPTGKSAFEQIDLDGAPHLIYSFSVSFASLNENVPVTIHIIKDELEFQQQIAQFNQQL
WTWLLILILVMLVFQLSWLIWTIRPLARFTQELHDVEQGKSTQLSSLYPSELQEVARQLN
ILLNTEQTQRKRYRNALADLAHSLKTPLAVIKSQADLSEASSEQVSNISRIISHQLKRAQ
TAASASWHLGIKVDEVGVKLLRTLAKIYREPQIDLSGEMAPQAVFKGDEADLTEILGNLL
DNACKAAKSQVKLTVTGDAYQLQLCIEDDGPGISEALQTQIFERGIRADSYRQGNGIGLA
IVRDLVDSYNGRISVSRSENLGGAKFTVNFTHSA