Protein Info for Shewana3_4018 in Shewanella sp. ANA-3

Name: envZ
Annotation: osmolarity sensor protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details PF00672: HAMP" amino acids 177 to 228 (52 residues), 50.2 bits, see alignment 3.9e-17 PF00512: HisKA" amino acids 234 to 292 (59 residues), 40.1 bits, see alignment E=4.7e-14 PF02518: HATPase_c" amino acids 335 to 438 (104 residues), 91.3 bits, see alignment E=8.3e-30

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 100% identity to shn:Shewana3_4018)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2G6 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Shewana3_4018 osmolarity sensor protein (RefSeq) (Shewanella sp. ANA-3)
MKPKFWWRFLPRSAFSQTVMLIGCLLLINQLVSYVTVAVYVLKPSYQQINQLIARQINLL
FVDGIDIGREHLTIVDALNAKVRDDGMKVYNQQQAREAGIEQATYYGFWSSQMSEYLGGD
AEVRVTHGTVLQIWIRPPQAPSVWIKVPLIGQNVSDLSPLTLYLMVIGALSVAGGWWFAR
QQNRPLRRLQKAAIAVSRGEFPEPLPLKGSSELVEVTNAFNQMSHSMKQLEQDRALLMAG
ISHDLRTPLTRIRLASEMMVEEDQYLKDGIVNDIEDMDAIISQFIAYIRQDQEASREPGQ
INKLIQDIAQAEANRDGQIEVVLSDCPEALFQGLAIKRVLSNLVENAFRYGSGWVRISSQ
FDGKRIGFSVEDNGPGIDESQIPKLFQPFTQGDIARGSVGSGLGLAIIKRIIDRHQGQVT
LSNRTEGGLKAQVWLPLE