Protein Info for Shewana3_3997 in Shewanella sp. ANA-3

Annotation: cytochrome oxidase assembly (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 5 to 24 (20 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details PF02628: COX15-CtaA" amino acids 5 to 341 (337 residues), 248.6 bits, see alignment E=4.3e-78

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 100% identity to shn:Shewana3_3997)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2E6 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Shewana3_3997 cytochrome oxidase assembly (RefSeq) (Shewanella sp. ANA-3)
MQLTWLLRITIVFTLLVILMGAYTRLSDAGLGCPDWPGCYGHIKVPTHDHEISHAQTLFP
DHDIHPEKAWLEMIHRYIAGALGILVLLILILCLKTSQAPKKLPLAIVLLIIFQAALGMW
TVTMKLMPIVVMSHLIGGFSLLSLLLLLYLRTRPRRIFETADIHNQRVAGAGFNGSHGSR
IGTSLKFLGQSKHLPKLALLSLVVLIGQIMLGAWTSSNYAALACTALPICEGNWMDNLAI
ADAFSPFQGQHPSFEFGVLDYHARMTIHIAHRVGAIITASLLLLLAYRLFFSTQLKALSL
LLVALVILQVSLGISNVVMHLPLGIAVSHNGGAALLLLTLVAINYFLWRRAP