Protein Info for Shewana3_3987 in Shewanella sp. ANA-3

Annotation: aromatic amino acid transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 15 to 406 (392 residues), 475.1 bits, see alignment E=1e-146 TIGR00837: aromatic amino acid transport protein" amino acids 19 to 399 (381 residues), 478.9 bits, see alignment E=7e-148

Best Hits

Swiss-Prot: 61% identical to MTR_PSEAB: Tryptophan-specific transport protein (mtr) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K03835, tryptophan-specific transport protein (inferred from 99% identity to shm:Shewmr7_3860)

Predicted SEED Role

"Tryptophan-specific transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2D6 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Shewana3_3987 aromatic amino acid transporter (RefSeq) (Shewanella sp. ANA-3)
MANHMNAVKNKPVGKSLLGGAMIIAGTTVGAGMFSLPVVGAGMWFGYSVLMLLGIWFCML
MSGLLLLETNLHFEPGASFDTLTKETLGQFWRIVNGVSIAFVLYILTYAYISGGGSIVNH
SLQGMGIELPQSVAGLVFAVVLACIVLISTKAVDRITTIMLGGMIITFFLAIGNLLIEID
VTKLLEPDGNQSFMPYLWAALPFGLASFGYHGNVPSLVKYYGKDSSTIIKAIFVGTFIAL
IIYACWLVATMGNIPRSQFSEIIAQGGNMGVLVGALSKVMESSWLNSMLTLFANLAVASS
FLGVTLGLFDYLADLFGFDDTRSGRMKTAIVTFVPPTILGLLFPDGFLIAIGFAALAATV
WAVIVPALMAYKSRQQFPNHQGFRVFGGTPLIILVVLYGVVTGACHLLAMANLLPQFS