Protein Info for Shewana3_3982 in Shewanella sp. ANA-3

Annotation: RND family efflux transporter MFP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF19335: HMBD" amino acids 59 to 85 (27 residues), 51.9 bits, see alignment (E = 1.1e-17) amino acids 132 to 159 (28 residues), 49.3 bits, see alignment (E = 7.3e-17) TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 183 to 484 (302 residues), 129.1 bits, see alignment E=8.9e-42 PF16576: HlyD_D23" amino acids 192 to 408 (217 residues), 260.2 bits, see alignment E=2.3e-81 PF13437: HlyD_3" amino acids 306 to 404 (99 residues), 55.5 bits, see alignment E=1.6e-18

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 100% identity to shn:Shewana3_3982)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2D1 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Shewana3_3982 RND family efflux transporter MFP subunit (RefSeq) (Shewanella sp. ANA-3)
MNQFHKVKKPGPKAVLILSSLLMGTPWLTQAQLANPATQAEAGHEHAHDSHSANQVKTYT
CPMHPEVESHEPGRCPKCNMFLVEKEEEEEASTAAQHAEHQAANQNAAQVFDTPTPKANS
LVKSQSSGATIKYVCPMHAHIISDVPGTCPICGMNLEKVETGGNTQEININVSGSMQQAL
ALKVAEAKRDTLWKFVETVGQIDYDESQINHVHARVTGWIEKLMIKSVGDSVKKGQLLYE
IYSPDLINAQDDYLLALDTAKSAGNSGRYQDLVRKAGLRLSLLGMNEKQIQQLADSRKTQ
YRVPFYALQDGIVKELAVRDGMYIQPSTEVMSVVDLSKVWVIADVFENEQSWIAVGQKAE
VSVPAMNISGIEGTIDYIYPELDPVTRSLRVRVVLNNTDISLRPKTLAKVSLFGGPNKDV
LVIPQEALIQTGKENRVIVKQADDSFTAKAVTVGMMSQGKAEIVSGLSEGERVVTSGQFL
LDSEASLKGSLMRLSSGHQH