Protein Info for Shewana3_3971 in Shewanella sp. ANA-3

Annotation: cell division ATP-binding protein FtsE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 TIGR02673: cell division ATP-binding protein FtsE" amino acids 1 to 214 (214 residues), 286.5 bits, see alignment E=6.4e-90 PF00005: ABC_tran" amino acids 18 to 165 (148 residues), 129 bits, see alignment E=2.1e-41

Best Hits

Swiss-Prot: 64% identical to FTSE_ECO57: Cell division ATP-binding protein FtsE (ftsE) from Escherichia coli O157:H7

KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 100% identity to she:Shewmr4_3773)

MetaCyc: 45% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2C0 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Shewana3_3971 cell division ATP-binding protein FtsE (RefSeq) (Shewanella sp. ANA-3)
MIDFQQVSKIYPGGQMALEEVNFHLQKGEMAFLTGHSGAGKSTLLKLITVIERATTGRVA
INGHDIAKISPKHVPYLRRNIGMIFQNHHLLMDRSVFDNVALPLVIEGFSHGEIRKRVAG
ALDMVGLYGKERHNPIMLSGGEQQRVGIARAIVNKPPLLLADEPTGNLDPKLSMDILRLF
ETFNDAGTSVLIATHDLGLIARMKYRTFTLKQGRMLGAQELHHGHATARGDGL