Protein Info for Shewana3_3966 in Shewanella sp. ANA-3

Annotation: alpha/beta hydrolase fold (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 TIGR03695: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase" amino acids 12 to 259 (248 residues), 275.8 bits, see alignment E=1.7e-86 PF00561: Abhydrolase_1" amino acids 13 to 177 (165 residues), 93.7 bits, see alignment E=4.6e-30 PF00975: Thioesterase" amino acids 14 to 132 (119 residues), 31 bits, see alignment E=8.6e-11 PF12697: Abhydrolase_6" amino acids 15 to 254 (240 residues), 74.4 bits, see alignment E=6.3e-24 PF12146: Hydrolase_4" amino acids 15 to 153 (139 residues), 32.8 bits, see alignment E=1.3e-11 PF03096: Ndr" amino acids 34 to 256 (223 residues), 28.7 bits, see alignment E=1.7e-10 PF00756: Esterase" amino acids 84 to 219 (136 residues), 22.3 bits, see alignment E=3e-08

Best Hits

KEGG orthology group: K08680, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC: 4.2.99.20] (inferred from 100% identity to shn:Shewana3_3966)

Predicted SEED Role

"2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.2.99.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L2B5 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Shewana3_3966 alpha/beta hydrolase fold (RefSeq) (Shewanella sp. ANA-3)
MPTVARYGEVSMPNLVLLHGFLGTKADWLPLIPALSQHFHCICLDLPGHGDNQHELPSTL
ANGFEHCVQDIISRLDRLGIESFYLYGYSLGGRIALHLAKAYPQRVLSLWLESCHPGLTD
TAEQAARSKNDNLWAKRLLSLSSRDFLQLWYQQAVFADMSDKARHALVAKRASLLDQHPK
QTLKQIFLATSLARQASLWDVPESLGYECHFFAGSQDAKFTAIAKDWQAQQPIILHQIEQ
AGHNIHQANPTALVACLSALKLKKSMT