Protein Info for Shewana3_3948 in Shewanella sp. ANA-3

Annotation: Bcr/CflA subfamily drug resistance transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 301 to 325 (25 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 7 to 382 (376 residues), 246.2 bits, see alignment E=3.8e-77 PF07690: MFS_1" amino acids 10 to 354 (345 residues), 163.2 bits, see alignment E=1.3e-51 PF06609: TRI12" amino acids 37 to 177 (141 residues), 25.2 bits, see alignment E=8.8e-10 PF00083: Sugar_tr" amino acids 39 to 182 (144 residues), 29 bits, see alignment E=7.8e-11

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 98% identity to shm:Shewmr7_3823)

Predicted SEED Role

"Putative multidrug resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L297 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Shewana3_3948 Bcr/CflA subfamily drug resistance transporter (RefSeq) (Shewanella sp. ANA-3)
MRRNLLPILMSLVLLSPLAIDIYLPSMPTMAAEFAVSASEVQSTLVLFLFAMGVGQILIG
PLADRYGRRPVALFGVLLYGASSLLAAAAIEFHWLQLARVLQGLAACSTSIVVFSAVRDC
YSPKEGARIYSYLNGAICVIPALAPTLGGLLAMQFGWRSTFVFMTLYAILMMLLVGYRLP
ETRPANTVSSGPLYRWSRYKPVLSNTHFLFYAFACMSAMAAILSYVSYSPVWLIGHLGVS
ELAFSGLFGLNALVNIVACFAAPVVIRKLGNRPTAILALVLLVLSAVLIIAAQAFGPSVG
MAAAFAFMLPMMLLCIGFAFLLGPATSMALSAFGERAGTATAMLGFIQMSGASVIAGLVQ
QTSLTAPYAVALVMGVFSVGLLSMMALSRFDHWHQEQLAAEH