Protein Info for Shewana3_3913 in Shewanella sp. ANA-3

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 PF13237: Fer4_10" amino acids 179 to 232 (54 residues), 28.6 bits, see alignment 6e-10 amino acids 416 to 465 (50 residues), 25.6 bits, see alignment 5.2e-09 PF12838: Fer4_7" amino acids 194 to 235 (42 residues), 28.8 bits, see alignment 7.5e-10 PF00037: Fer4" amino acids 417 to 438 (22 residues), 26.1 bits, see alignment (E = 3e-09) amino acids 449 to 469 (21 residues), 22.8 bits, see alignment (E = 3.4e-08) PF12800: Fer4_4" amino acids 421 to 435 (15 residues), 15.4 bits, see alignment (E = 1.1e-05) amino acids 453 to 466 (14 residues), 14.4 bits, see alignment (E = 2.3e-05) PF13187: Fer4_9" amino acids 422 to 469 (48 residues), 28.7 bits, see alignment 6.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3913)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L262 at UniProt or InterPro

Protein Sequence (553 amino acids)

>Shewana3_3913 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MTNQTQLALKQARQNVLAQTQILQNLIPPTVSYTTEGTVLIIGPEDLARLAADKLSTMAS
RVILANEAITSQDETHLEQVMAAATDVESYYNKLIGIKGFLGQFQVSVEHQNGAAELSVV
AIRKAHFDLILDLSSTPCLNLEMLPPGYFYVGQDDAKLADALEQLPELVGQFDKPRYVKI
NADLCAHDRNGINGCNRCLNFCPADAISSVAKKIEVDPYLCHGAGSCASACPTGAIGYDL
PTPQALHSYLNKIINRYREQAQTAPVILFHDNAVGASLIGDDLAGDVLPVALEEITVASI
DHWLAALAWGARQVLILNTEATAPTLTQMLKGELALANSMLDEIGQPQRLSLIDPSMLTN
LEPLLDISLDWPVIVPGAFAPTTKRNTLFDAIDHLNSQAGEINSSLSINNVPYGKVSVNV
EKCTLCMSCVAICPTMALQDGGDKPALHFIEQNCVQCGLCEAACPEKVISLTPQINFDKA
ARQQLQTLKEEAPFECIRCGSPFATQSMVHRMLDMVGAHSAFSANIERLKMCGDCRVKDM
FEDILQDPEKQLR