Protein Info for Shewana3_3903 in Shewanella sp. ANA-3

Annotation: ornithine carbamoyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR00658: ornithine carbamoyltransferase" amino acids 2 to 300 (299 residues), 348.2 bits, see alignment E=2e-108 PF02729: OTCace_N" amino acids 2 to 140 (139 residues), 161.2 bits, see alignment E=1.9e-51 PF00185: OTCace" amino acids 147 to 298 (152 residues), 174 bits, see alignment E=2.4e-55

Best Hits

Swiss-Prot: 96% identical to OTC_SHEON: Ornithine carbamoyltransferase (argF) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 99% identity to shm:Shewmr7_0238)

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L252 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Shewana3_3903 ornithine carbamoyltransferase (RefSeq) (Shewanella sp. ANA-3)
MKHLLSIKELTQQQLLDLITLAKTIKANPAEYRHALDGKSVVMLFEKPSLRTRVSFDIGI
NKLGGHCLYLDQQNGALGKRESVADFASNLSCWADAIVARTFSHKTIEQLAEFGTVPVIN
ALSDLYHPCQALADFLTLAEHFENISDVKLAYVGDGNNVTNSLMYCAAILGATMTVICPA
GHFPDGYVVAEVQELASRYGGKVVLTSDIGAIEGHDAIYTDTWISMGDPTPLAEIKDKFA
PYQVNKGLMAKAGAHFFMHCLPAHRGVEVTDEVMDGEGSLILQQAENRMHAQNAVLITLF
S