Protein Info for Shewana3_3896 in Shewanella sp. ANA-3

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04351: PilP" amino acids 22 to 168 (147 residues), 166.6 bits, see alignment E=1.7e-53

Best Hits

KEGG orthology group: K02665, type IV pilus assembly protein PilP (inferred from 99% identity to she:Shewmr4_3700)

Predicted SEED Role

"Type IV pilus biogenesis protein PilP" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L245 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Shewana3_3896 methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella sp. ANA-3)
MKLLPLLALSLFLMGCVGDRSDLELFVTTTKAQHVAHIPPLKEPPKFEHFAYQAELMRSP
FVPPSRELTEEVVDTSKNCLQPDLKRRKGRLETYALDNLKMRGTLSEGNSIWALIETNDG
SVYRMGVGEYLGLFNGHIAKVTSQNVEVVELIPDGSGCWSERTNNIELSGK