Protein Info for Shewana3_3893 in Shewanella sp. ANA-3

Name: aroB
Annotation: 3-dehydroquinate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01357: 3-dehydroquinate synthase
  • amino acids 14 to 355 (342 residues), 407.6 bits, E=2.2e-126
• PF13685: Fe-ADH_2
  • amino acids 18 to 243 (226 residues), 48.2 bits, E=2e-16
• PF00465: Fe-ADH
  • amino acids 27 to 185 (159 residues), 32.2 bits, E=8.3e-12
• PF01761: DHQ_synthase
  • amino acids 67 to 325 (259 residues), 375.5 bits, E=1.8e-116

Best Hits

Swiss-Prot: 100% identical to AROB_SHESA: 3-dehydroquinate synthase (aroB) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 100% identity to shn:Shewana3_3893)

MetaCyc: 62% identical to 3-dehydroquinate synthase (Escherichia coli K-12 substr. MG1655)
3-dehydroquinate synthase. [EC: 4.2.3.4]

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• 3-dehydroquinate biosynthesis I (2/2 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

See A0L242 at UniProt or InterPro

Protein Sequence (359 amino acids)

>Shewana3_3893 3-dehydroquinate synthase (RefSeq) (Shewanella sp. ANA-3)
MTKQIQVDLGERSYPIYIGQSLMSDGETLSRYLLKKRILIVTNETVAPLYLKQIQDTMAS
FGEVTSVILPDGEQFKDLTHLDSIFTALLQRNYGRDSVLVALGGGVIGDMTGFAAACYQR
GVDFIQIPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPQIVIIDTECLQTLPAREFAA
GMAEVIKYGIMWDAEFFQWLENNVQALKSLDTQALVYAISRCCEIKADVVSQDETEQGVR
ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGTVLAAQTAKSMGLIDESIVRRIVQLFHAF
DLPVTAPESMDFDSFIKHMRRDKKVLGGQIRLVLPTAIGRADVFSQVPESTLEQVICCA