Protein Info for Shewana3_3892 in Shewanella sp. ANA-3

Annotation: sporulation domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 234 to 252 (19 residues), see Phobius details PF13401: AAA_22" amino acids 26 to 147 (122 residues), 55.5 bits, see alignment E=7.5e-19 PF05036: SPOR" amino acids 380 to 441 (62 residues), 36.7 bits, see alignment E=4.3e-13

Best Hits

KEGG orthology group: K03112, DamX protein (inferred from 100% identity to shn:Shewana3_3892)

Predicted SEED Role

"DamX, an inner membrane protein involved in bile resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L241 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Shewana3_3892 sporulation domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MTFQGQVLLPSQEALVERLHHVASYSDQLLVLVGAHGSGKTTLLTALATDFDESNAALVI
CPMHADNAEIRRKILVQLVSSPIFDDEISLAETILRVAPKQSKPLHIIIDDAHLLSKELW
AECIILNQVQCAGQRIAVTLAVPPAFLADLLPQLPESLRRQILPVSIDPLSLPEREALYQ
TLLRYSDQNPFTPRDIVRAQLEKQTGTPQEVVALLELALHGQGEKKSVWTQYKVALIGFA
SVLIAVVIWLGLAKPFSGEPIPEVVTYPAVDSAEFLAHGKQILAPYFKQRAESLTQALLA
EAVEQADPLAKFHGEEPQAEGETGIAPPVDEATSKGDSSATEIDEAEPAPAPTEQAKDDT
ATQVVHVTPAPVSAVSVRPKTGYAIQIATVSQRETVQSLLKKLHNVPEVRVAKYKQFWVV
LVGQFNDSQSAQQAAAELVKEYHLSQPLIKKWAELGGYQLQETRSSGEISE