Protein Info for Shewana3_3887 in Shewanella sp. ANA-3

Annotation: phosphoglycolate phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00702: Hydrolase" amino acids 5 to 186 (182 residues), 110.1 bits, see alignment E=4.7e-35 PF13419: HAD_2" amino acids 8 to 191 (184 residues), 131 bits, see alignment E=1.3e-41 PF12710: HAD" amino acids 8 to 182 (175 residues), 39.5 bits, see alignment E=2.1e-13 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 8 to 218 (211 residues), 209.7 bits, see alignment E=7.6e-66 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 73 to 191 (119 residues), 31.3 bits, see alignment E=4.3e-11 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 86 to 186 (101 residues), 41.6 bits, see alignment E=3.4e-14 PF13242: Hydrolase_like" amino acids 149 to 216 (68 residues), 38.3 bits, see alignment E=2.7e-13

Best Hits

Swiss-Prot: 48% identical to GPH_PHOPR: Phosphoglycolate phosphatase (PBPRA0285) from Photobacterium profundum (strain SS9)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to shn:Shewana3_3887)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L236 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Shewana3_3887 phosphoglycolate phosphatase (RefSeq) (Shewanella sp. ANA-3)
MREQIKAIAFDLDGTLIDSVPDLAVATQAALAELGLARCTEAQVRTWVGNGAEMLMRRAM
SHALGTDVEQAALDAAMPIFMHHYQENLEKHSALYADVHQVLQILFDAGFKLAVVTNKPY
RFTLPLLEAFKINDFFSLVLGGDSLAKMKPDPLPLEHLLAEWQLDKSELLMVGDSKNDIL
AAKAAGVASIGLTYGYNYGEDIGLTGPDAVCEQFAEILRWLNLAQPV