Protein Info for Shewana3_3848 in Shewanella sp. ANA-3

Annotation: RND family efflux transporter MFP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 39 to 356 (318 residues), 229.1 bits, see alignment E=3.3e-72 PF16576: HlyD_D23" amino acids 63 to 264 (202 residues), 58 bits, see alignment E=1.3e-19 PF13533: Biotin_lipoyl_2" amino acids 67 to 111 (45 residues), 47.9 bits, see alignment 1.4e-16 PF13437: HlyD_3" amino acids 161 to 268 (108 residues), 42.2 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3848)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1Z7 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Shewana3_3848 RND family efflux transporter MFP subunit (RefSeq) (Shewanella sp. ANA-3)
MSIFEKNHKVTFLIFGAVLLLVGCEQSQIDTKETVSRPVKLLQVEQTPSTSTYRYPGSVS
SVKEAVLAFEVPGKVIKLHVKEGDFVKQDTVLAEIDDRDYQAQLDSAKSDLIVAKSDFQR
YEKALKADAVTPQAFQQAKRNLEVAQAAFNQADKALTETKLIAPFAGRVVTREIDLFATV
HAKQPIMQLHSESAYEMVVSVPESDWAQGERVNSAADIKLDNQLFVTLTAFPDKRFEGKI
TEFSGQADAATRTYKVKVAFSVPDKTPISSGMTGHAIYLSSNESTNILSIPLDAIVGNSD
NSAFVWLYDPINGQVTKKSITIGNITEQTVNVLSGLKVGDVIAVSGVHSLYDGYPVYPMK
D