Protein Info for Shewana3_3838 in Shewanella sp. ANA-3

Annotation: DSBA oxidoreductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13462: Thioredoxin_4
  • amino acids 35 to 194 (160 residues), 57.4 bits, E=2.2e-19
• PF01323: DSBA
  • amino acids 43 to 184 (142 residues), 65.1 bits, E=7.7e-22

Best Hits

Swiss-Prot: 38% identical to DSBA_VIBCH: Thiol:disulfide interchange protein DsbA (dsbA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03673, thiol:disulfide interchange protein DsbA (inferred from 100% identity to shn:Shewana3_3838)

MetaCyc: 38% identical to thiol:disulfide oxidoreductase DsbA (Escherichia coli K-12 substr. MG1655)
RXN-21426 [EC: 1.8.4.15]; 1.8.4.15 [EC: 1.8.4.15]

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

• cytochrome c biogenesis (system I type) (8/11 steps found)
• periplasmic disulfide bond formation (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.15

Sequence Analysis Tools

See A0L1Y7 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Shewana3_3838 DSBA oxidoreductase (RefSeq) (Shewanella sp. ANA-3)
MKKALLMVAALLLAPLTVSAVEYKEGVHYTVINDGPATAKPEITEFFSFYCPHCYNFSKT
VVPKILAEKPEGVAFNQAHVDFIGKEMGVEMSRAFAVAHQLNVDDKMDAALFSAIHEKKQ
HFTNRDDVRALFVANGVDGKAFDSAADSFMVKAQMAKMKRDTENAKISGVPALVVNGKYR
VETGAIKSYDELLDIAYYLAKKQ