Protein Info for Shewana3_3835 in Shewanella sp. ANA-3

Annotation: Na+/H+ antiporter NhaC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 52 (25 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 359 to 387 (29 residues), see Phobius details amino acids 399 to 416 (18 residues), see Phobius details amino acids 442 to 462 (21 residues), see Phobius details amino acids 469 to 490 (22 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 161 to 462 (302 residues), 146.8 bits, see alignment E=4.6e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3835)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1Y4 at UniProt or InterPro

Protein Sequence (501 amino acids)

>Shewana3_3835 Na+/H+ antiporter NhaC (RefSeq) (Shewanella sp. ANA-3)
MSPNLLAILPLLLTLVLALWLRRTLVALGVGILSGALIIAQFDILQSLGYLLEIGAKQFY
SQDAWQWWHLNVLMAMLLLGSMTQLLARSGAVEQFGDWLYRRIRTGRQARIGVVLLGWLV
FIDGIFSCLAVGHVCQPLSQRYGIRQTQLAYLVDSNASPLCSLLPFSSWGPYVMALLAGL
SFLPVSALEAFIDVALSNFYAITTLGLSLIVAWFGMGFSSIEKALLAAEPVEPSLSSSKG
NPWLLAIPMLTLLGASVGLTLWSGAQQVPSWDISAWLAKADIGAAMRDACLLSTLVTLVL
LMLSGRSIGKLLGDLAHGVRMIAFAIAILLCTWMIGAVIQDLGVASLLASWAKLYLSPSL
LVAGMFLLCAIMAFATGSSWGTFAIMLPIGGEIAHNMDASLLLPVLSAVMAGSVFGDHCS
PISDTSVLSATSSGCLPHDHVVTQLPFALIGAGAALVGFQLVNLSVATLFVWCGVIGTAL
GLLALLTRFYPPWLSARSQTN