Protein Info for Shewana3_3818 in Shewanella sp. ANA-3

Annotation: two component LuxR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF00072: Response_reg" amino acids 3 to 114 (112 residues), 93.8 bits, see alignment E=1.6e-30 PF00196: GerE" amino acids 137 to 192 (56 residues), 50.5 bits, see alignment E=2.6e-17 PF08281: Sigma70_r4_2" amino acids 138 to 180 (43 residues), 29.8 bits, see alignment 7.4e-11

Best Hits

Swiss-Prot: 46% identical to YVFU_BACSU: Uncharacterized transcriptional regulatory protein YvfU (yvfU) from Bacillus subtilis (strain 168)

KEGG orthology group: K07693, two-component system, NarL family, response regulator DesR (inferred from 100% identity to shn:Shewana3_3818)

Predicted SEED Role

"Two-component system regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1W7 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Shewana3_3818 two component LuxR family transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MHILLAEDQAMVRGALAALLTLAGGFTITQASNGDEALNLLKQQHFDLLLTDIEMPGRTG
LELATWLKEQHSHTKVVVITTFGRAGYIKRAIEAGVGGFLLKDAPSETLVHAIQQVIAGK
RIIDPELAIMAIGDVDPLNDKERRALRFASEGKSTAEIAEMLFIAEGTVRNYLSEAIAKL
NASNRIDAARIAKQKGWL