Protein Info for Shewana3_3817 in Shewanella sp. ANA-3

Annotation: putative signal transduction histidine kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 118 (53 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details PF07730: HisKA_3" amino acids 171 to 238 (68 residues), 64.6 bits, see alignment E=1e-21 PF02518: HATPase_c" amino acids 271 to 355 (85 residues), 28.2 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: K07778, two-component system, NarL family, sensor histidine kinase DesK [EC: 2.7.13.3] (inferred from 100% identity to shn:Shewana3_3817)

Predicted SEED Role

"sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1W6 at UniProt or InterPro

Protein Sequence (359 amino acids)

>Shewana3_3817 putative signal transduction histidine kinase (RefSeq) (Shewanella sp. ANA-3)
MTQHSVQIEQKIAWVYLINLAFYLIPLFVTPYPSWQIGLILAVLIPFIYSYFWAYRCHTR
VAYRPISVMLLLAIAITPINPGSISLFTFASFFIGFFYPLRVSLLSWFGILALLFLLNHF
SQFNNLYFPLYGSALVFGVGMLGIAEQKRYQHRLKERQSAQEISTLATMVERERIARDLH
DIMGHSLSSIALKAELAEKLLAKQEYQLATTQLQELGQIARESLSQIRHTVSDYKHKGLA
SCVTQLCHSLRDKGIAVELLGELPKLSARAESQLGLVLTELVNNILRHSSASQCRIQFRE
QADSLIVDVQDNAPTSPIIEGNGLTGIRERLTSLGGHLSYDLEQGYAFSVSLPLQGATD