Protein Info for Shewana3_3815 in Shewanella sp. ANA-3

Annotation: CaCA family Na(+)/Ca(+) antiporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 30 to 47 (18 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 4 to 144 (141 residues), 116.6 bits, see alignment E=4.9e-38 amino acids 167 to 306 (140 residues), 107.2 bits, see alignment E=4e-35 TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 6 to 302 (297 residues), 246.6 bits, see alignment E=1.7e-77

Best Hits

KEGG orthology group: K07301, inner membrane protein (inferred from 99% identity to she:Shewmr4_3618)

Predicted SEED Role

"Inner membrane protein YrbG, predicted calcium/sodium:proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1W4 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Shewana3_3815 CaCA family Na(+)/Ca(+) antiporter (RefSeq) (Shewanella sp. ANA-3)
MLIALSIIGGFIILTLGAEALVRGASSIALRLGITPLIIGLTIVAFGTSAPELAVSVKSA
LAGNSGIALGNVIGSNIANIGLILAITALIRPIQVQSQMVRRDIPLMILASMLFWGLLFD
GELSLIDGVILLSLLVGYLVFSYFSSKNTTDADGEIIEEGPKNPLLSVAFIVVGIGMLVG
GGILFVNGAVDLAKVFGVSEVIIGLTIVAIGTSMPELVTSVLAALKGESDIAIGNVVGSN
LFNILGILGVTAIVHPVSALGFQSFDFIVMLALAVVILPFAWSGLRIGRREGATLLVAYL
GYMIYLVNQASTQAVV