Protein Info for Shewana3_3779 in Shewanella sp. ANA-3

Annotation: phage integrase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF13356: Arm-DNA-bind_3" amino acids 2 to 86 (85 residues), 70.6 bits, see alignment E=2e-23 PF14659: Phage_int_SAM_3" amino acids 95 to 148 (54 residues), 23.2 bits, see alignment 1.4e-08 PF22022: Phage_int_M" amino acids 103 to 187 (85 residues), 39.3 bits, see alignment E=1.3e-13 PF00589: Phage_integrase" amino acids 202 to 378 (177 residues), 69.2 bits, see alignment E=8e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3779)

Predicted SEED Role

"Phage Integrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1S8 at UniProt or InterPro

Protein Sequence (404 amino acids)

>Shewana3_3779 phage integrase family protein (RefSeq) (Shewanella sp. ANA-3)
MNDKQIKAFIRSKTATRKLVDDGLYIRVQTEGKASWELRYTSNGKRRFMTLEGGQYPHMS
LADARAAAAILKQSISKGGDPLAERAKIGQEKIQTVDDLFNDWFVDAKKRLKHSEIPLRI
YTKEVQPYIGRLQIKDVTPLDIRNIIQKVAHSNRPTTANDTLLHCKKLFTHACKLGLKDG
NPASHFKPADAGGVEKSRERALSVEELKQFFSVAKDNISSFGRDNYLASALLVCLGVRKG
ELLKLTWQEIDLNLKLWKLPQPRTKSSKAISIPLPDSVVEWFEELQIRACGSDYVFPNRK
ASKKPHVSGDTLNRAVASLFGHDSSKTRQPINRMGEIPYFTIHDFRRTCRSLLAKQGVPS
HIAERCLNHKIKGVEGIYDRYDYFDERLDALNSVANLIAPIVNC