Protein Info for Shewana3_3760 in Shewanella sp. ANA-3

Annotation: 3-isopropylmalate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00180: Iso_dh" amino acids 4 to 354 (351 residues), 454 bits, see alignment E=2e-140 TIGR00169: 3-isopropylmalate dehydrogenase" amino acids 4 to 347 (344 residues), 525.8 bits, see alignment E=2.4e-162

Best Hits

Swiss-Prot: 98% identical to LEU3_SHEON: 3-isopropylmalate dehydrogenase (leuB) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00052, 3-isopropylmalate dehydrogenase [EC: 1.1.1.85] (inferred from 98% identity to son:SO_4235)

MetaCyc: 72% identical to 3-isopropylmalate dehydrogenase (Escherichia coli K-12 substr. MG1655)
3-isopropylmalate dehydrogenase. [EC: 1.1.1.85]

Predicted SEED Role

"3-isopropylmalate dehydrogenase (EC 1.1.1.85)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 1.1.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1Q9 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Shewana3_3760 3-isopropylmalate dehydrogenase (RefSeq) (Shewanella sp. ANA-3)
MSYQIAVLAGDGIGPEVMAEARKVLKAVEARFGLNIEYSEYDVGGIAIDNHGCPLPEATL
KGCEAADAILFGSVGGPKWEKLPPNEQPERGALLPLRGHFELFCNLRPAKLHDGLEHMSP
LRSDISARGFDVLCVRELTGGIYFGKPKGRQGEGESEEAFDTMRYSRREIARIARIAFEA
ARGRRKKVTSVDKANVLACSVLWRQVVEEVAVDFPDVELEHIYIDNATMQLLRRPDEFDV
MLCSNLFGDILSDEIAMLTGSMGLLSSASMNSTGFGLFEPAGGSAPDIAGKGIANPIAQI
LSAALMLRHSLKQEEAASAIERAVSKALNSGYLTGELLSSDQRHKAKSTVEMGNFIADAV
KAGV