Protein Info for Shewana3_3748 in Shewanella sp. ANA-3

Name: murE
Annotation: UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 301 to 319 (19 residues), see Phobius details TIGR01085: UDP-N-acetylmuramyl-tripeptide synthetase" amino acids 22 to 488 (467 residues), 507.9 bits, see alignment E=1.6e-156 PF01225: Mur_ligase" amino acids 23 to 97 (75 residues), 44.3 bits, see alignment E=2.9e-15 PF08245: Mur_ligase_M" amino acids 113 to 316 (204 residues), 183.9 bits, see alignment E=5.6e-58 PF02875: Mur_ligase_C" amino acids 339 to 465 (127 residues), 119 bits, see alignment E=3.8e-38

Best Hits

Swiss-Prot: 93% identical to MURE_SHEON: UDP-N-acetylmuramyl-tripeptide synthetase (murE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01928, UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [EC: 6.3.2.13] (inferred from 100% identity to shn:Shewana3_3748)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1P7 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Shewana3_3748 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase (RefSeq) (Shewanella sp. ANA-3)
MMLLRDLLAPWFPYAGEQTFLELTLDSRAIRRGDVFLALPGHKVDGRQFIDKALAQGATA
VLVHTDKIDEQGKVIATEQGVQIYFYQLARQVSAVAAVRYPVVQGQSMGIVGITGTNGKT
STSQLCAQLVTLLEGKAAVMGTLGNGLWGELVDSGNTTADAITLMRQLHEFADKGVNTCA
MEVSSHGLVQGRVDAVPFDVAVFTNLTRDHLDYHGDMENYAEAKQMLFRFDSLLHGLVNL
DDPVGAAWLSELANVPAKMWGFSIEAHTEVAFYTKNAQFNDQGVQATLVWPEGEVDIRSP
LLGAFNLSNLLAALSALYLQGMDMRALASKVPYLVPVAGRMERFTTADNITLVVDYAHTP
DAIEQALNALRRHCAGELWCVFGCGGDRDKGKRPLMGQAAEQCADRIMVTSDNARSEDPN
QIITDIIQGLTHPERALTEVDRVAAIKHVVAQAKPGDVILLAGKGHETYQEAAGVRHDYD
ERALARQLSEQSQ