Protein Info for Shewana3_3745 in Shewanella sp. ANA-3

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21799: MurD-like_N
  • amino acids 7 to 95 (89 residues), 103 bits, E=1.3e-33
• TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • amino acids 9 to 434 (426 residues), 402.7 bits, E=1.2e-124
• PF08245: Mur_ligase_M
  • amino acids 114 to 279 (166 residues), 84.4 bits, E=1.6e-27
• PF02875: Mur_ligase_C
  • amino acids 302 to 413 (112 residues), 61.3 bits, E=2.6e-20

Best Hits

Swiss-Prot: 97% identical to MURD_SHEON: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 99% identity to shm:Shewmr7_0384)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

See A0L1P4 at UniProt or InterPro

Protein Sequence (439 amino acids)

>Shewana3_3745 UDP-N-acetylmuramoylalanine--D-glutamate ligase (RefSeq) (Shewanella sp. ANA-3)
MQSQYSHIVLGLGATGLSVVRYLCGKGITPLVMDSRRQPPGADTLASAFPEVQLIAGGFD
CRYLVQATQIIISPGIAIDTPEVRAALDMGIEVIGDVELFAREIADRKPCVIGITGSNGK
STVTTLVGEMLREAGMAVAVGGNIGIPALDLLTENADIFVLELSSFQLETTHSLNCVAST
CLNVTEDHMDRYSDMDAYRKAKLRLYHQSRSIIFNRDDALTIPTEPMNQNSFGLAPPEGD
EWGICDSKIYHGHSEIMPITEVSLIGSHNHANLLAAMALVYAVGVEKQVMAKVARTFTGL
SHRCEVVGVKAGVTYVNDSKATNVGATVAALDGLSDHLGDIILIAGGDGKGADFSPLVEP
LTKVTHLITLGRDGNKIAALKEGAIKVDSMAAAVAKAAELATSGDIVLLSPACASLDMYS
NFMARGDDFRSQVEQLDGE