Protein Info for Shewana3_3744 in Shewanella sp. ANA-3

Annotation: cell division protein FtsW (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 166 to 183 (18 residues), see Phobius details amino acids 189 to 206 (18 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 287 to 312 (26 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details TIGR02614: cell division protein FtsW" amino acids 34 to 389 (356 residues), 425.2 bits, see alignment E=1.1e-131 PF01098: FTSW_RODA_SPOVE" amino acids 36 to 391 (356 residues), 381.6 bits, see alignment E=1.8e-118

Best Hits

Swiss-Prot: 83% identical to FTSW_SHESH: Probable peptidoglycan glycosyltransferase FtsW (ftsW) from Shewanella sediminis (strain HAW-EB3)

KEGG orthology group: K03588, cell division protein FtsW (inferred from 100% identity to shn:Shewana3_3744)

MetaCyc: 56% identical to peptidoglycan glycosyltransferase FtsW (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Cell division protein FtsW" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129

Use Curated BLAST to search for 2.4.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1P3 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Shewana3_3744 cell division protein FtsW (RefSeq) (Shewanella sp. ANA-3)
MASDARQLSLFGRVLNALPNWQRDNEVPGVQLYDRALLTAVLSLIGFGFVMVMSASMPEA
QTLTGNPFHFMTRHVGYLLGCLVIAAFVLRVEMQTWQRMSPIMLLGVFLMLLAVLVVGTT
VNGATRWLSIGPIRIQVAEVAKFAFSVYMAGYLVRRHQEVRENAKGFYKPIAVFAIYAIL
ILMQPDLGTVVVLFVGTVGLLFLAGARLLDFFALIFAGVLAFVALVLLEPYRMRRVTSFL
DPWQDPFGSGYQLTQSLMAYGRGDWFGQGLGNSIQKLEYLPEAHTDFIFAVIGEELGFIG
IIAVLSVLLFVALRAIRLGNLCLAMDKAFEGYLAYAIGIWICFQTVVNVGASIGMLPTKG
LTLPFVSYGGSSLWVMTAAAMTLLRIDYERRMSLVQAVQGRLK