Protein Info for Shewana3_3720 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF13528: Glyco_trans_1_3" amino acids 1 to 126 (126 residues), 54.5 bits, see alignment E=5.4e-19 amino acids 169 to 300 (132 residues), 59.4 bits, see alignment E=1.8e-20 TIGR00661: conserved hypothetical protein" amino acids 2 to 300 (299 residues), 224.3 bits, see alignment E=1.2e-70

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3720)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1L9 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Shewana3_3720 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MRILYGVQGTGNGHLSRARVMAKALIEHNIQVDFLFSGRKPEHFFDMECFGEYRVQAGMT
FATHSGRVNVPQTVRQNCSLSLLKDIQALDLSCYDLVLNDFEPVSAWAARRQGVPSIGIS
HQAALTHPVPKLGSTWFNELLLNYFAPVDVALGCHWHHFGFPILPPFVEVDASPIEHTHQ
ILVYLPFEEADAIAAFFKPFTDYQFLVYHAKQPTTPLADHIQWHGFNRDGFKQHLASCGG
VIGNAGFELASEALTLGKKLLVKPLIGQFEQLSNVAALQLLGAGDSMMSLDTGVVKRWLK
AASPNPITYPQVGDALVKWICSGQWQHTASLCDDLWSQVKLPDTWR