Protein Info for Shewana3_3718 in Shewanella sp. ANA-3

Annotation: DedA family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details PF09335: SNARE_assoc" amino acids 38 to 154 (117 residues), 69.2 bits, see alignment E=2.3e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_3718)

Predicted SEED Role

"FIG139438: lipoprotein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L1L7 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Shewana3_3718 DedA family protein (RefSeq) (Shewanella sp. ANA-3)
MPEALQHLITEMTPWLQQYGYLLLFVAIAVEGFGIPAPGQSLLIVASLLASTGQMSLPLV
LIVACAAALSGNSLGYFIGRRFGEVLLQKGWIKPQLEDKIHSVIGQYGIAALVLSRFVEG
LKQFMFIGCGLAKMPFKQFVMGNLLATSIWVTLFGLGPVFIRDEIAPILAFYHQHKYPTW
AIVSLLLILLLHFSWRKFQVKNQ